OLFML3,HNOEL-iso
  • OLFML3,HNOEL-iso

Anti-OLFML3 Antibody 25ul

Ref: AN-HPA027991-25ul
Anti-OLFML3

Información del producto

Polyclonal Antibody against Human OLFML3, Gene description: olfactomedin like 3, Alternative Gene Names: HNOEL-iso, OLF44, Validated applications: ICC, Uniprot ID: Q9NRN5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OLFML3
Gene Description olfactomedin like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE
Immunogen LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HNOEL-iso, OLF44
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRN5
HTS Code 3002150000
Gene ID 56944
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OLFML3 Antibody 25ul

Anti-OLFML3 Antibody 25ul