CBL,c-Cbl,CBL2,RNF55
  • CBL,c-Cbl,CBL2,RNF55

Anti-CBL Antibody 25ul

Ref: AN-HPA027956-25ul
Anti-CBL

Información del producto

Polyclonal Antibody against Human CBL, Gene description: Cbl proto-oncogene, E3 ubiquitin protein ligase, Alternative Gene Names: c-Cbl, CBL2, RNF55, Validated applications: ICC, IHC, WB, Uniprot ID: P22681, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CBL
Gene Description Cbl proto-oncogene, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
Immunogen PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-Cbl, CBL2, RNF55
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P22681
HTS Code 3002150000
Gene ID 867
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CBL Antibody 25ul

Anti-CBL Antibody 25ul