MSRB2,CBS-1,CBS1
  • MSRB2,CBS-1,CBS1

Anti-MSRB2 Antibody 25ul

Ref: AN-HPA027933-25ul
Anti-MSRB2

Información del producto

Polyclonal Antibody against Human MSRB2, Gene description: methionine sulfoxide reductase B2, Alternative Gene Names: CBS-1, CBS1, CGI-131, MSRB, PILB, Validated applications: IHC, WB, Uniprot ID: Q9Y3D2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MSRB2
Gene Description methionine sulfoxide reductase B2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSV
Immunogen TCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CBS-1, CBS1, CGI-131, MSRB, PILB
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3D2
HTS Code 3002150000
Gene ID 22921
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MSRB2 Antibody 25ul

Anti-MSRB2 Antibody 25ul