EEF1E1,AIMP3,P18
  • EEF1E1,AIMP3,P18

Anti-EEF1E1 Antibody 100ul

Ref: AN-HPA027901-100ul
Anti-EEF1E1

Información del producto

Polyclonal Antibody against Human EEF1E1, Gene description: eukaryotic translation elongation factor 1 epsilon 1, Alternative Gene Names: AIMP3, P18, Validated applications: IHC, WB, Uniprot ID: O43324, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EEF1E1
Gene Description eukaryotic translation elongation factor 1 epsilon 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL
Immunogen LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AIMP3, P18
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43324
HTS Code 3002150000
Gene ID 9521
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EEF1E1 Antibody 100ul

Anti-EEF1E1 Antibody 100ul