NMUR1,FM-3,GPC-R
  • NMUR1,FM-3,GPC-R

Anti-NMUR1 Antibody 100ul

Ref: AN-HPA027895-100ul
Anti-NMUR1

Información del producto

Polyclonal Antibody against Human NMUR1, Gene description: neuromedin U receptor 1, Alternative Gene Names: FM-3, GPC-R, GPR66, NMU1R, Validated applications: IHC, Uniprot ID: Q9HB89, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NMUR1
Gene Description neuromedin U receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP
Immunogen TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FM-3, GPC-R, GPR66, NMU1R
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HB89
HTS Code 3002150000
Gene ID 10316
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NMUR1 Antibody 100ul

Anti-NMUR1 Antibody 100ul