POM121L12
  • POM121L12

Anti-POM121L12 Antibody 100ul

Ref: AN-HPA027836-100ul
Anti-POM121L12

Información del producto

Polyclonal Antibody against Human POM121L12, Gene description: POM121 transmembrane nucleoporin-like 12, Alternative Gene Names: DKFZp564N2472, Validated applications: IHC, Uniprot ID: Q8N7R1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POM121L12
Gene Description POM121 transmembrane nucleoporin-like 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KRPEANGPPAMGSAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQSHIQYFQWGRPVPSTHLIEVRPTQDPAKPQRVVSEG
Immunogen KRPEANGPPAMGSAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQSHIQYFQWGRPVPSTHLIEVRPTQDPAKPQRVVSEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp564N2472
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N7R1
HTS Code 3002150000
Gene ID 285877
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POM121L12 Antibody 100ul

Anti-POM121L12 Antibody 100ul