P4HA2,C-P4Halpha(II)
  • P4HA2,C-P4Halpha(II)

Anti-P4HA2 Antibody 100ul

Ref: AN-HPA027824-100ul
Anti-P4HA2

Información del producto

Polyclonal Antibody against Human P4HA2, Gene description: prolyl 4-hydroxylase, alpha polypeptide II, Alternative Gene Names: C-P4Halpha(II), Validated applications: ICC, IHC, WB, Uniprot ID: O15460, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name P4HA2
Gene Description prolyl 4-hydroxylase, alpha polypeptide II
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence LDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMS
Immunogen LDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C-P4Halpha(II)
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15460
HTS Code 3002150000
Gene ID 8974
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-P4HA2 Antibody 100ul

Anti-P4HA2 Antibody 100ul