ZNF131,pHZ-10,ZBTB35
  • ZNF131,pHZ-10,ZBTB35

Anti-ZNF131 Antibody 25ul

Ref: AN-HPA027748-25ul
Anti-ZNF131

Información del producto

Polyclonal Antibody against Human ZNF131, Gene description: zinc finger protein 131, Alternative Gene Names: pHZ-10, ZBTB35, Validated applications: ICC, Uniprot ID: P52739, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF131
Gene Description zinc finger protein 131
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQVTVEQVHPDLLQD
Immunogen GRKKLYECQVCNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQVTVEQVHPDLLQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names pHZ-10, ZBTB35
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52739
HTS Code 3002150000
Gene ID 7690
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF131 Antibody 25ul

Anti-ZNF131 Antibody 25ul