PEX2,PAF-1,PMP35
  • PEX2,PAF-1,PMP35

Anti-PEX2 Antibody 100ul

Ref: AN-HPA027729-100ul
Anti-PEX2

Información del producto

Polyclonal Antibody against Human PEX2, Gene description: peroxisomal biogenesis factor 2, Alternative Gene Names: PAF-1, PMP35, PXMP3, RNF72, ZWS3, Validated applications: IHC, Uniprot ID: P28328, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PEX2
Gene Description peroxisomal biogenesis factor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LGIHSVFCKPQNIREVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNA
Immunogen LGIHSVFCKPQNIREVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PAF-1, PMP35, PXMP3, RNF72, ZWS3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28328
HTS Code 3002150000
Gene ID 5828
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PEX2 Antibody 100ul

Anti-PEX2 Antibody 100ul