DNAH14,C1orf67
  • DNAH14,C1orf67

Anti-DNAH14 Antibody 25ul

Ref: AN-HPA027718-25ul
Anti-DNAH14

Información del producto

Polyclonal Antibody against Human DNAH14, Gene description: dynein, axonemal, heavy chain 14, Alternative Gene Names: C1orf67, DKFZp781B1548, Dnahc14, HL-18, HL18, MGC27277, Validated applications: IHC, Uniprot ID: Q0VDD8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DNAH14
Gene Description dynein, axonemal, heavy chain 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR
Immunogen FIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEWMNCQRNWLYLEPVFHSSEIRR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf67, DKFZp781B1548, Dnahc14, HL-18, HL18, MGC27277
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q0VDD8
HTS Code 3002150000
Gene ID 127602
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAH14 Antibody 25ul

Anti-DNAH14 Antibody 25ul