NEDD8,Nedd-8
  • NEDD8,Nedd-8

Anti-NEDD8 Antibody 100ul

Ref: AN-HPA027583-100ul
Anti-NEDD8

Información del producto

Polyclonal Antibody against Human NEDD8, Gene description: neural precursor cell expressed, developmentally down-regulated 8, Alternative Gene Names: Nedd-8, Validated applications: ICC, Uniprot ID: Q15843, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NEDD8
Gene Description neural precursor cell expressed, developmentally down-regulated 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL
Immunogen TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Nedd-8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15843
HTS Code 3002150000
Gene ID 4738
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NEDD8 Antibody 100ul

Anti-NEDD8 Antibody 100ul