RCC1,CHC1
  • RCC1,CHC1

Anti-RCC1 Antibody 100ul

Ref: AN-HPA027573-100ul
Anti-RCC1

Información del producto

Polyclonal Antibody against Human RCC1, Gene description: regulator of chromosome condensation 1, Alternative Gene Names: CHC1, Validated applications: ICC, IHC, WB, Uniprot ID: P18754, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RCC1
Gene Description regulator of chromosome condensation 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
Immunogen IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P18754
HTS Code 3002150000
Gene ID 1104
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RCC1 Antibody 100ul

Anti-RCC1 Antibody 100ul