SPP1,BNSP,BSPI
  • SPP1,BNSP,BSPI

Anti-SPP1 Antibody 25ul

Ref: AN-HPA027541-25ul
Anti-SPP1

Información del producto

Polyclonal Antibody against Human SPP1, Gene description: secreted phosphoprotein 1, Alternative Gene Names: BNSP, BSPI, ETA-1, OPN, Validated applications: ICC, IHC, WB, Uniprot ID: P10451, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPP1
Gene Description secreted phosphoprotein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT
Immunogen SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BNSP, BSPI, ETA-1, OPN
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P10451
HTS Code 3002150000
Gene ID 6696
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPP1 Antibody 25ul

Anti-SPP1 Antibody 25ul