ZSCAN26,SRE-ZBP
  • ZSCAN26,SRE-ZBP

Anti-ZSCAN26 Antibody 100ul

Ref: AN-HPA027521-100ul
Anti-ZSCAN26

Información del producto

Polyclonal Antibody against Human ZSCAN26, Gene description: zinc finger and SCAN domain containing 26, Alternative Gene Names: SRE-ZBP, ZNF187, Validated applications: ICC, Uniprot ID: Q16670, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZSCAN26
Gene Description zinc finger and SCAN domain containing 26
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GETGQQVDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKGEETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQRFIQHLDLIEHASTHTGKKLCESDVCQSSSLT
Immunogen GETGQQVDPDQPKKQKILVEEMAPLKGVQEQQVRHECEVTKPEKEKGEETRIENGKLIVVTDSCGRVESSGKISEPMEAHNEGSNLERHQAKPKEKIEYKCSEREQRFIQHLDLIEHASTHTGKKLCESDVCQSSSLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SRE-ZBP, ZNF187
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16670
HTS Code 3002150000
Gene ID 7741
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZSCAN26 Antibody 100ul

Anti-ZSCAN26 Antibody 100ul