FAS,APO-1,APT1,CD95
  • FAS,APO-1,APT1,CD95

Anti-FAS Antibody 25ul

Ref: AN-HPA027444-25ul
Anti-FAS

Información del producto

Polyclonal Antibody against Human FAS, Gene description: Fas cell surface death receptor, Alternative Gene Names: APO-1, APT1, CD95, FAS1, TNFRSF6, Validated applications: ICC, IHC, WB, Uniprot ID: P25445, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAS
Gene Description Fas cell surface death receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Immunogen QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APO-1, APT1, CD95, FAS1, TNFRSF6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25445
HTS Code 3002150000
Gene ID 355
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAS Antibody 25ul

Anti-FAS Antibody 25ul