RC3H1,KIAA2025
  • RC3H1,KIAA2025

Anti-RC3H1 Antibody 25ul

Ref: AN-HPA027434-25ul
Anti-RC3H1

Información del producto

Polyclonal Antibody against Human RC3H1, Gene description: ring finger and CCCH-type domains 1, Alternative Gene Names: KIAA2025, RNF198, roquin, RP5-1198E17.5, Validated applications: IHC, Uniprot ID: Q5TC82, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RC3H1
Gene Description ring finger and CCCH-type domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
Immunogen AHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA2025, RNF198, roquin, RP5-1198E17.5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TC82
HTS Code 3002150000
Gene ID 149041
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RC3H1 Antibody 25ul

Anti-RC3H1 Antibody 25ul