PPP1R8,ard-1,ARD1
  • PPP1R8,ard-1,ARD1

Anti-PPP1R8 Antibody 100ul

Ref: AN-HPA027417-100ul
Anti-PPP1R8

Información del producto

Polyclonal Antibody against Human PPP1R8, Gene description: protein phosphatase 1, regulatory subunit 8, Alternative Gene Names: ard-1, ARD1, NIPP-1, NIPP1, PRO2047, Validated applications: ICC, IHC, WB, Uniprot ID: Q12972, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP1R8
Gene Description protein phosphatase 1, regulatory subunit 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence THSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Immunogen THSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ard-1, ARD1, NIPP-1, NIPP1, PRO2047
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12972
HTS Code 3002150000
Gene ID 5511
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP1R8 Antibody 100ul

Anti-PPP1R8 Antibody 100ul