SWT1,C1orf26
  • SWT1,C1orf26

Anti-SWT1 Antibody 25ul

Ref: AN-HPA027334-25ul
Anti-SWT1

Información del producto

Polyclonal Antibody against Human SWT1, Gene description: SWT1 RNA endoribonuclease homolog (S. cerevisiae), Alternative Gene Names: C1orf26, FLJ20121, HsSwt1, Validated applications: ICC, IHC, Uniprot ID: Q5T5J6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SWT1
Gene Description SWT1 RNA endoribonuclease homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSDYQDVETLYNFLIKYEVNKNVKFTAQEIYDCVSQTEYREKLTIGC
Immunogen ALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSDYQDVETLYNFLIKYEVNKNVKFTAQEIYDCVSQTEYREKLTIGC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf26, FLJ20121, HsSwt1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T5J6
HTS Code 3002150000
Gene ID 54823
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SWT1 Antibody 25ul

Anti-SWT1 Antibody 25ul