POLR3GL,flj32422
  • POLR3GL,flj32422

Anti-POLR3GL Antibody 25ul

Ref: AN-HPA027288-25ul
Anti-POLR3GL

Información del producto

Polyclonal Antibody against Human POLR3GL, Gene description: polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like, Alternative Gene Names: flj32422, MGC3200, Validated applications: IHC, WB, Uniprot ID: Q9BT43, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POLR3GL
Gene Description polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
Immunogen VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names flj32422, MGC3200
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BT43
HTS Code 3002150000
Gene ID 84265
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POLR3GL Antibody 25ul

Anti-POLR3GL Antibody 25ul