CCDC181,C1orf114
  • CCDC181,C1orf114

Anti-CCDC181 Antibody 100ul

Ref: AN-HPA027275-100ul
Anti-CCDC181

Información del producto

Polyclonal Antibody against Human CCDC181, Gene description: coiled-coil domain containing 181, Alternative Gene Names: C1orf114, FLJ25846, Validated applications: IHC, Uniprot ID: Q5TID7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC181
Gene Description coiled-coil domain containing 181
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FELLNLQDIASQGFLPPINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKTCPSSAVNSDRSKGN
Immunogen FELLNLQDIASQGFLPPINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKTCPSSAVNSDRSKGN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf114, FLJ25846
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TID7
HTS Code 3002150000
Gene ID 57821
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC181 Antibody 100ul

Anti-CCDC181 Antibody 100ul