STXBP3,UNC-18C
  • STXBP3,UNC-18C

Anti-STXBP3 Antibody 100ul

Ref: AN-HPA027225-100ul
Anti-STXBP3

Información del producto

Polyclonal Antibody against Human STXBP3, Gene description: syntaxin binding protein 3, Alternative Gene Names: UNC-18C, Validated applications: IHC, WB, Uniprot ID: O00186, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STXBP3
Gene Description syntaxin binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLF
Immunogen FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names UNC-18C
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00186
HTS Code 3002150000
Gene ID 6814
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STXBP3 Antibody 100ul

Anti-STXBP3 Antibody 100ul