GORAB,FLJ11752,GO
  • GORAB,FLJ11752,GO

Anti-GORAB Antibody 25ul

Ref: AN-HPA027208-25ul
Anti-GORAB

Información del producto

Polyclonal Antibody against Human GORAB, Gene description: golgin, RAB6-interacting, Alternative Gene Names: FLJ11752, GO, NTKL-BP1, SCYL1BP1, Validated applications: ICC, IHC, WB, Uniprot ID: Q5T7V8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GORAB
Gene Description golgin, RAB6-interacting
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP
Immunogen MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11752, GO, NTKL-BP1, SCYL1BP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T7V8
HTS Code 3002150000
Gene ID 92344
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GORAB Antibody 25ul

Anti-GORAB Antibody 25ul