ERRFI1,GENE-33
  • ERRFI1,GENE-33

Anti-ERRFI1 Antibody 100ul

Ref: AN-HPA027206-100ul
Anti-ERRFI1

Información del producto

Polyclonal Antibody against Human ERRFI1, Gene description: ERBB receptor feedback inhibitor 1, Alternative Gene Names: GENE-33, MIG-6, RALT, Validated applications: ICC, WB, Uniprot ID: Q9UJM3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERRFI1
Gene Description ERBB receptor feedback inhibitor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY
Immunogen NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GENE-33, MIG-6, RALT
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJM3
HTS Code 3002150000
Gene ID 54206
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERRFI1 Antibody 100ul

Anti-ERRFI1 Antibody 100ul