RBM6,3G2,DEF-3,DEF3
  • RBM6,3G2,DEF-3,DEF3

Anti-RBM6 Antibody 25ul

Ref: AN-HPA027164-25ul
Anti-RBM6

Información del producto

Polyclonal Antibody against Human RBM6, Gene description: RNA binding motif protein 6, Alternative Gene Names: 3G2, DEF-3, DEF3, g16, NY-LU-12, Validated applications: ICC, IHC, Uniprot ID: P78332, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM6
Gene Description RNA binding motif protein 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH
Immunogen DFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 3G2, DEF-3, DEF3, g16, NY-LU-12
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78332
HTS Code 3002150000
Gene ID 10180
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RBM6 Antibody 25ul

Anti-RBM6 Antibody 25ul