Ver mas grande
Anti-EYS Antibody 25ul
AN-HPA027103-25ul
Producto nuevo
Anti-EYS
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25ul |
| Gene Name | EYS |
| Gene Description | eyes shut homolog (Drosophila) |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC |
| Sequence | CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR |
| Immunogen | CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | bA166P24.2, bA307F22.3, bA74E24.1, C6orf178, C6orf179, C6orf180, dJ1018A4.2, dJ303F19.1, EGFL10, EGFL11, RP25, SPAM |
| Categoria | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q5T1H1 |
| HTS Code | 3002150000 |
| Gene ID | 346007 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human EYS, Gene description: eyes shut homolog (Drosophila), Alternative Gene Names: bA166P24.2, bA307F22.3, bA74E24.1, C6orf178, C6orf179, C6orf180, dJ1018A4.2, dJ303F19.1, EGFL10, EGFL11, RP25, SPAM, Validated applications: IHC, Uniprot ID: Q5T1H1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF