GPER1,CEPR,CMKRL2
  • GPER1,CEPR,CMKRL2

Anti-GPER1 Antibody 100ul

Ref: AN-HPA027052-100ul
Anti-GPER1

Información del producto

Polyclonal Antibody against Human GPER1, Gene description: G protein-coupled estrogen receptor 1, Alternative Gene Names: CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR, Validated applications: IHC, Uniprot ID: Q99527, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GPER1
Gene Description G protein-coupled estrogen receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Immunogen MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99527
HTS Code 3002150000
Gene ID 2852
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GPER1 Antibody 100ul

Anti-GPER1 Antibody 100ul