CYB561D1,FLJ39035
  • CYB561D1,FLJ39035

Anti-CYB561D1 Antibody 25ul

Ref: AN-HPA027028-25ul
Anti-CYB561D1

Información del producto

Polyclonal Antibody against Human CYB561D1, Gene description: cytochrome b561 family, member D1, Alternative Gene Names: FLJ39035, FLJ44753, Validated applications: IHC, WB, Uniprot ID: Q8N8Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYB561D1
Gene Description cytochrome b561 family, member D1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Immunogen MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ39035, FLJ44753
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N8Q1
HTS Code 3002150000
Gene ID 284613
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CYB561D1 Antibody 25ul

Anti-CYB561D1 Antibody 25ul