VN1R4,V1RL4
  • VN1R4,V1RL4

Anti-VN1R4 Antibody 25ul

Ref: AN-HPA027018-25ul
Anti-VN1R4

Información del producto

Polyclonal Antibody against Human VN1R4, Gene description: vomeronasal 1 receptor 4, Alternative Gene Names: V1RL4, Validated applications: IHC, Uniprot ID: Q7Z5H5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VN1R4
Gene Description vomeronasal 1 receptor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL
Immunogen TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names V1RL4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z5H5
HTS Code 3002150000
Gene ID 317703
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VN1R4 Antibody 25ul

Anti-VN1R4 Antibody 25ul