SLC35C2,bA394O2.1
  • SLC35C2,bA394O2.1

Anti-SLC35C2 Antibody 100ul

Ref: AN-HPA027011-100ul
Anti-SLC35C2

Información del producto

Polyclonal Antibody against Human SLC35C2, Gene description: solute carrier family 35 (GDP-fucose transporter), member C2, Alternative Gene Names: bA394O2.1, C20orf5, CGI-15, OVCOV1, Validated applications: ICC, IHC, Uniprot ID: Q9NQQ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC35C2
Gene Description solute carrier family 35 (GDP-fucose transporter), member C2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
Immunogen KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA394O2.1, C20orf5, CGI-15, OVCOV1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQQ7
HTS Code 3002150000
Gene ID 51006
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC35C2 Antibody 100ul

Anti-SLC35C2 Antibody 100ul