NECTIN1,CD111
  • NECTIN1,CD111

Anti-NECTIN1 Antibody 100ul

Ref: AN-HPA026846-100ul
Anti-NECTIN1

Información del producto

Polyclonal Antibody against Human NECTIN1, Gene description: nectin cell adhesion molecule 1, Alternative Gene Names: CD111, CLPED1, ED4, HIgR, HVEC, OFC7, PRR, PRR1, PVRL1, PVRR1, SK-12, Validated applications: IHC, Uniprot ID: Q15223, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NECTIN1
Gene Description nectin cell adhesion molecule 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Immunogen DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD111, CLPED1, ED4, HIgR, HVEC, OFC7, PRR, PRR1, PVRL1, PVRR1, SK-12
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15223
HTS Code 3002150000
Gene ID 5818
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NECTIN1 Antibody 100ul

Anti-NECTIN1 Antibody 100ul