SPINK2,HUSI-II
  • SPINK2,HUSI-II

Anti-SPINK2 Antibody 100ul

Ref: AN-HPA026813-100ul
Anti-SPINK2

Información del producto

Polyclonal Antibody against Human SPINK2, Gene description: serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor), Alternative Gene Names: HUSI-II, Validated applications: IHC, Uniprot ID: P20155, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPINK2
Gene Description serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Immunogen KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HUSI-II
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P20155
HTS Code 3002150000
Gene ID 6691
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPINK2 Antibody 100ul

Anti-SPINK2 Antibody 100ul