SLC25A39,CGI-69
  • SLC25A39,CGI-69

Anti-SLC25A39 Antibody 25ul

Ref: AN-HPA026785-25ul
Anti-SLC25A39

Información del producto

Polyclonal Antibody against Human SLC25A39, Gene description: solute carrier family 25, member 39, Alternative Gene Names: CGI-69, FLJ22407, Validated applications: IHC, Uniprot ID: Q9BZJ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC25A39
Gene Description solute carrier family 25, member 39
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTL
Immunogen RLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-69, FLJ22407
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BZJ4
HTS Code 3002150000
Gene ID 51629
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC25A39 Antibody 25ul

Anti-SLC25A39 Antibody 25ul