DHDDS,DS,FLJ13102
  • DHDDS,DS,FLJ13102

Anti-DHDDS Antibody 100ul

Ref: AN-HPA026721-100ul
Anti-DHDDS

Información del producto

Polyclonal Antibody against Human DHDDS, Gene description: dehydrodolichyl diphosphate synthase, Alternative Gene Names: DS, FLJ13102, HDS, RP59, Validated applications: IHC, Uniprot ID: Q86SQ9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DHDDS
Gene Description dehydrodolichyl diphosphate synthase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA
Immunogen RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DS, FLJ13102, HDS, RP59
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86SQ9
HTS Code 3002150000
Gene ID 79947
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DHDDS Antibody 100ul

Anti-DHDDS Antibody 100ul