IFT74,CCDC2,CMG-1
  • IFT74,CCDC2,CMG-1

Anti-IFT74 Antibody 100ul

Ref: AN-HPA026684-100ul
Anti-IFT74

Información del producto

Polyclonal Antibody against Human IFT74, Gene description: intraflagellar transport 74, Alternative Gene Names: CCDC2, CMG-1, CMG1, FLJ22621, Validated applications: IHC, Uniprot ID: Q96LB3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFT74
Gene Description intraflagellar transport 74
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KIKKLHQERMILSTHRNAFKKIMEKQNIEYEALKTQLQENETHSQLTNLERKWQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTSG
Immunogen KIKKLHQERMILSTHRNAFKKIMEKQNIEYEALKTQLQENETHSQLTNLERKWQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCDC2, CMG-1, CMG1, FLJ22621
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96LB3
HTS Code 3002150000
Gene ID 80173
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IFT74 Antibody 100ul

Anti-IFT74 Antibody 100ul