C1orf64,ERRF
  • C1orf64,ERRF

Anti-C1orf64 Antibody 25ul

Ref: AN-HPA026676-25ul
Anti-C1orf64

Información del producto

Polyclonal Antibody against Human C1orf64, Gene description: chromosome 1 open reading frame 64, Alternative Gene Names: ERRF, MGC24047, Validated applications: IHC, WB, Uniprot ID: Q8NEQ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C1orf64
Gene Description chromosome 1 open reading frame 64
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Immunogen HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERRF, MGC24047
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEQ6
HTS Code 3002150000
Gene ID 149563
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C1orf64 Antibody 25ul

Anti-C1orf64 Antibody 25ul