ERO1A,ERO1-alpha
  • ERO1A,ERO1-alpha

Anti-ERO1A Antibody 25ul

Ref: AN-HPA026653-25ul
Anti-ERO1A

Información del producto

Polyclonal Antibody against Human ERO1A, Gene description: endoplasmic reticulum oxidoreductase alpha, Alternative Gene Names: ERO1-alpha, Ero1alpha, ERO1L, Validated applications: IHC, WB, Uniprot ID: Q96HE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ERO1A
Gene Description endoplasmic reticulum oxidoreductase alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence LLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKE
Immunogen LLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERO1-alpha, Ero1alpha, ERO1L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HE7
HTS Code 3002150000
Gene ID 30001
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERO1A Antibody 25ul

Anti-ERO1A Antibody 25ul