IFI30,GILT,IFI-30
  • IFI30,GILT,IFI-30

Anti-IFI30 Antibody 100ul

Ref: AN-HPA026650-100ul
Anti-IFI30

Información del producto

Polyclonal Antibody against Human IFI30, Gene description: interferon, gamma-inducible protein 30, Alternative Gene Names: GILT, IFI-30, IP30, MGC32056, Validated applications: ICC, IHC, WB, Uniprot ID: P13284, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IFI30
Gene Description interferon, gamma-inducible protein 30
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK
Immunogen LVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GILT, IFI-30, IP30, MGC32056
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13284
HTS Code 3002150000
Gene ID 10437
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IFI30 Antibody 100ul

Anti-IFI30 Antibody 100ul