PITPNC1,RDGB-BETA
  • PITPNC1,RDGB-BETA

Anti-PITPNC1 Antibody 25ul

Ref: AN-HPA026563-25ul
Anti-PITPNC1

Información del producto

Polyclonal Antibody against Human PITPNC1, Gene description: phosphatidylinositol transfer protein, cytoplasmic 1, Alternative Gene Names: RDGB-BETA, RDGBB, RDGBB1, Validated applications: IHC, Uniprot ID: Q9UKF7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PITPNC1
Gene Description phosphatidylinositol transfer protein, cytoplasmic 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence FAWVDEWYDMTMDEVREFERATQGATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCR
Immunogen FAWVDEWYDMTMDEVREFERATQGATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RDGB-BETA, RDGBB, RDGBB1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKF7
HTS Code 3002150000
Gene ID 26207
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PITPNC1 Antibody 25ul

Anti-PITPNC1 Antibody 25ul