FAAP100,C17orf70
  • FAAP100,C17orf70

Anti-FAAP100 Antibody 100ul

Ref: AN-HPA026532-100ul
Anti-FAAP100

Información del producto

Polyclonal Antibody against Human FAAP100, Gene description: Fanconi anemia core complex associated protein 100, Alternative Gene Names: C17orf70, FLJ22175, Validated applications: IHC, Uniprot ID: Q0VG06, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAAP100
Gene Description Fanconi anemia core complex associated protein 100
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VLCSVSPSGSRVPHDLLGGSGGFTLEDALFGLLFGADATLLQSPVVLCGLPDGQLCCVILKALVTSRSAPGDPNALVKILHHLEEPVIFIGALKTEPQAAEAAENFLPDEDVHCDC
Immunogen VLCSVSPSGSRVPHDLLGGSGGFTLEDALFGLLFGADATLLQSPVVLCGLPDGQLCCVILKALVTSRSAPGDPNALVKILHHLEEPVIFIGALKTEPQAAEAAENFLPDEDVHCDC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C17orf70, FLJ22175
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q0VG06
HTS Code 3002150000
Gene ID 80233
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAAP100 Antibody 100ul

Anti-FAAP100 Antibody 100ul