PKDCC,SgK493,Vlk
  • PKDCC,SgK493,Vlk

Anti-PKDCC Antibody 100ul

Ref: AN-HPA026526-100ul
Anti-PKDCC

Información del producto

Polyclonal Antibody against Human PKDCC, Gene description: protein kinase domain containing, cytoplasmic, Alternative Gene Names: SgK493, Vlk, Validated applications: IHC, Uniprot ID: Q504Y2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PKDCC
Gene Description protein kinase domain containing, cytoplasmic
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD
Immunogen QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SgK493, Vlk
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q504Y2
HTS Code 3002150000
Gene ID 91461
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PKDCC Antibody 100ul

Anti-PKDCC Antibody 100ul