YES1,c-yes,HsT441
  • YES1,c-yes,HsT441

Anti-YES1 Antibody 100ul

Ref: AN-HPA026480-100ul
Anti-YES1

Información del producto

Polyclonal Antibody against Human YES1, Gene description: YES proto-oncogene 1, Src family tyrosine kinase, Alternative Gene Names: c-yes, HsT441, Yes, Validated applications: ICC, IHC, WB, Uniprot ID: P07947, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YES1
Gene Description YES proto-oncogene 1, Src family tyrosine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS
Immunogen KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-yes, HsT441, Yes
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P07947
HTS Code 3002150000
Gene ID 7525
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YES1 Antibody 100ul

Anti-YES1 Antibody 100ul