GPR137B,TM7SF1
  • GPR137B,TM7SF1

Anti-GPR137B Antibody 100ul

Ref: AN-HPA026422-100ul
Anti-GPR137B

Información del producto

Polyclonal Antibody against Human GPR137B, Gene description: G protein-coupled receptor 137B, Alternative Gene Names: TM7SF1, Validated applications: IHC, WB, Uniprot ID: O60478, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GPR137B
Gene Description G protein-coupled receptor 137B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG
Immunogen RVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TM7SF1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60478
HTS Code 3002150000
Gene ID 7107
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GPR137B Antibody 100ul

Anti-GPR137B Antibody 100ul