RAB14,FBP,RAB-14
  • RAB14,FBP,RAB-14

Anti-RAB14 Antibody 100ul

Ref: AN-HPA026419-100ul
Anti-RAB14

Información del producto

Polyclonal Antibody against Human RAB14, Gene description: RAB14, member RAS oncogene family, Alternative Gene Names: FBP, RAB-14, Validated applications: ICC, IHC, WB, Uniprot ID: P61106, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB14
Gene Description RAB14, member RAS oncogene family
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
Immunogen GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FBP, RAB-14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61106
HTS Code 3002150000
Gene ID 51552
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAB14 Antibody 100ul

Anti-RAB14 Antibody 100ul