SLC27A2,ACSVL1
  • SLC27A2,ACSVL1

Anti-SLC27A2 Antibody 100ul

Ref: AN-HPA026089-100ul
Anti-SLC27A2

Información del producto

Polyclonal Antibody against Human SLC27A2, Gene description: solute carrier family 27 (fatty acid transporter), member 2, Alternative Gene Names: ACSVL1, FACVL1, FATP2, hFACVL1, HsT17226, VLACS, VLCS, Validated applications: IHC, Uniprot ID: O14975, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC27A2
Gene Description solute carrier family 27 (fatty acid transporter), member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGAT
Immunogen SLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGAT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACSVL1, FACVL1, FATP2, hFACVL1, HsT17226, VLACS, VLCS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14975
HTS Code 3002150000
Gene ID 11001
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC27A2 Antibody 100ul

Anti-SLC27A2 Antibody 100ul