TCF4,bHLHb19,E2-2
  • TCF4,bHLHb19,E2-2

Anti-TCF4 Antibody 100ul

Ref: AN-HPA025958-100ul
Anti-TCF4

Información del producto

Polyclonal Antibody against Human TCF4, Gene description: transcription factor 4, Alternative Gene Names: bHLHb19, E2-2, ITF2, SEF2-1B, Validated applications: IHC, Uniprot ID: P15884, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TCF4
Gene Description transcription factor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
Immunogen HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb19, E2-2, ITF2, SEF2-1B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P15884
HTS Code 3002150000
Gene ID 6925
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TCF4 Antibody 100ul

Anti-TCF4 Antibody 100ul