ACTRT2,Arp-T2,ARPM2
  • ACTRT2,Arp-T2,ARPM2

Anti-ACTRT2 Antibody 100ul

Ref: AN-HPA025079-100ul
Anti-ACTRT2

Información del producto

Polyclonal Antibody against Human ACTRT2, Gene description: actin-related protein T2, Alternative Gene Names: Arp-T2, ARPM2, FLJ25424, Validated applications: IHC, WB, Uniprot ID: Q8TDY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ACTRT2
Gene Description actin-related protein T2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIVLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAP
Immunogen ALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIVLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Arp-T2, ARPM2, FLJ25424
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDY3
HTS Code 3002150000
Gene ID 140625
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACTRT2 Antibody 100ul

Anti-ACTRT2 Antibody 100ul