GTF2E2,FE,TF2E2
  • GTF2E2,FE,TF2E2

Anti-GTF2E2 Antibody 100ul

Ref: AN-HPA025065-100ul
Anti-GTF2E2

Información del producto

Polyclonal Antibody against Human GTF2E2, Gene description: general transcription factor IIE, polypeptide 2, beta 34kDa, Alternative Gene Names: FE, TF2E2, TFIIE-B, Validated applications: ICC, IHC, WB, Uniprot ID: P29084, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GTF2E2
Gene Description general transcription factor IIE, polypeptide 2, beta 34kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
Immunogen PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FE, TF2E2, TFIIE-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P29084
HTS Code 3002150000
Gene ID 2961
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GTF2E2 Antibody 100ul

Anti-GTF2E2 Antibody 100ul