SH3GLB2,KIAA1848
  • SH3GLB2,KIAA1848

Anti-SH3GLB2 Antibody 100ul

Ref: AN-HPA024734-100ul
Anti-SH3GLB2

Información del producto

Polyclonal Antibody against Human SH3GLB2, Gene description: SH3-domain GRB2-like endophilin B2, Alternative Gene Names: KIAA1848, Validated applications: IHC, WB, Uniprot ID: Q9NR46, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SH3GLB2
Gene Description SH3-domain GRB2-like endophilin B2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HDFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLY
Immunogen HDFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1848
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NR46
HTS Code 3002150000
Gene ID 56904
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SH3GLB2 Antibody 100ul

Anti-SH3GLB2 Antibody 100ul