ZC2HC1A,C8orf70
  • ZC2HC1A,C8orf70

Anti-ZC2HC1A Antibody 100ul

Ref: AN-HPA024726-100ul
Anti-ZC2HC1A

Información del producto

Polyclonal Antibody against Human ZC2HC1A, Gene description: zinc finger, C2HC-type containing 1A, Alternative Gene Names: C8orf70, CGI-62, FAM164A, Validated applications: ICC, IHC, WB, Uniprot ID: Q96GY0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZC2HC1A
Gene Description zinc finger, C2HC-type containing 1A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence TYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL
Immunogen TYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C8orf70, CGI-62, FAM164A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GY0
HTS Code 3002150000
Gene ID 51101
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZC2HC1A Antibody 100ul

Anti-ZC2HC1A Antibody 100ul