VPS37A,FLJ32642
  • VPS37A,FLJ32642

Anti-VPS37A Antibody 100ul

Ref: AN-HPA024705-100ul
Anti-VPS37A

Información del producto

Polyclonal Antibody against Human VPS37A, Gene description: vacuolar protein sorting 37 homolog A (S. cerevisiae), Alternative Gene Names: FLJ32642, HCRP1, PQBP2, SPG53, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NEZ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VPS37A
Gene Description vacuolar protein sorting 37 homolog A (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB, ICC
Sequence DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
Immunogen DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32642, HCRP1, PQBP2, SPG53
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEZ2
HTS Code 3002150000
Gene ID 137492
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VPS37A Antibody 100ul

Anti-VPS37A Antibody 100ul